Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA595361

Invitrogen™ ABCB10 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595361
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595361 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595361 Supplier Invitrogen™ Supplier No. PA595361
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat cardiac muscle tissue, COLO320 whole cell, 22RV1 whole cell, PANC whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown.
TRUSTED_SUSTAINABILITY

Specifications

Antigen ABCB10
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene ABCB10
Gene Accession No. Q9NRK6
Gene Alias ABC transporter 10 protein; ABCB10; Abcb12; Abc-me; ABC-me protein; ABC-mitochondrial erythroid protein; ATP binding cassette subfamily B member 10; ATP-binding cassette sub-family B member 10, mitochondrial; ATP-binding cassette transporter 10; ATP-binding cassette, subfamily B (MDR/TAP), member 10; ATP-binding cassette, sub-family B (MDR/TAP), member 10; EST20237; M-ABC2; mitochondrial ATP-binding cassette 2; MTABC2; si:dkey-162b3.3
Gene Symbols ABCB10
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human ABCB10 (640-678aa QRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDR).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23456, 361439
Target Species Human, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.