Invitrogen™ ABCB10 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595361

Catalog No. PIPA595361

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat cardiac muscle tissue, COLO320 whole cell, 22RV1 whole cell, PANC whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown.

Specifications

• Antigen: ABCB10
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: ABCB10
• Gene Alias: ABC transporter 10 protein; ABCB10; Abcb12; Abc-me; ABC-me protein; ABC-mitochondrial erythroid protein; ATP binding cassette subfamily B member 10; ATP-binding cassette sub-family B member 10, mitochondrial; ATP-binding cassette transporter 10; ATP-binding cassette, subfamily B (MDR/TAP), member 10; ATP-binding cassette, sub-family B (MDR/TAP), member 10; EST20237; M-ABC2; mitochondrial ATP-binding cassette 2; MTABC2; si:dkey-162b3.3
• Host Species: Rabbit
• Purification Method: Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 23456, 361439
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: Q9NRK6
• Gene Symbols: ABCB10
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ABCB10 (640-678aa QRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDR).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Product Type: Antibody
• Isotype: IgG