Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ABL2 Antibody (2L9C6), R&D Systems™

ABL2 Antibody (2L9C6), R&D Systems™
SDP

Catalog No. NB526232
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB526232 20 μL
NB526233 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB526232 Supplier R&D Systems Supplier No. NBP33320520UL

Customers require a valid business account associated to their profile to access pricing and ordering options.

missing translation for 'validMainframeMsg'

Description

A Novus product, part of R&D Systems. Rabbit Monoclonal Antibody

ABL2 Monoclonal specifically detects ABL2 in Human∣Mouse∣Rat samples. It is validated for ELISA∣Western Blot.

Specifications

Antigen ABL2
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2L9C6
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL
Formulation PBS (pH 7.3), 50% glycerol, 0.05% BSA
Gene Alias Abelson murine leukemia viral (v-abl) oncogene homolog 2, Abelson murine leukemia viral oncogene homolog 2, Abelson-related gene protein, Abelson-relatedgene), arg tyrosine kinase, EC 2.7.10, EC 2.7.10.2, FLJ22224, FLJ31718, FLJ41441, tyrosine-protein kinase ABL2, Tyrosine-protein kinase ARG, v-abl Abelson murine leukemia viral oncogene homolog 2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-600 of human ABL2 (P42684).,, Sequence:, KGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEELGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATE
Purification Method Affinity purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 27
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Product Type Antibody
Form Purified
Isotype IgG
Product Line Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.