Invitrogen™ ACADVL Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA578710

Catalog No. PIPA578710

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell lysates, human SiHa whole cell lysates, human A431 whole cell lysates, human U251 whole cell lysates, rat liver tissue lysates, rat heart tissue lysates, mouse liver tissue lysates, mouse heart tissue lysates. IHC: human liver cancer tissue, human ovarian cancer tissue, rat heart tissue. Flow: U251 cell.

The protein encoded by this gene is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.

Specifications

• Antigen: ACADVL
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: ACADVL
• Gene Alias: ACAD6; Acadvl; acyl-CoA dehydrogenase, very long chain; acyl-Coenzyme A dehydrogenase, very long chain; LCACD; MVLCAD; Very long chain Acyl-Coa dehydrogenase; very long-chain specific acyl-CoA dehydrogenase, mitochondrial; Vlcad; VLCAD very-long-chain acyl-CoA dehydrogenase
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 11370, 25363, 37
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Immunoprecipitation, Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: P45953, P49748, P50544
• Gene Symbols: ACADVL
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ACADVL (538-576aa RALEQFATVVEAKLIKHKKGIVNEQFLLQRLADGAIDLY).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov