Invitrogen™ ACSL5 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA578714

Catalog No. PIPA578714

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat liver tissue, mouse liver tissue. Flow: HepG2 cell.

The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.

Specifications

• Antigen: ACSL5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: ACSL5
• Gene Alias: 1700030F05Rik; ACS2; ACS5; Acsl5; acyl-CoA synthetase 5; acyl-CoA synthetase long chain family member 5; acyl-CoA synthetase long-chain family member 5; Arachidonate--CoA ligase; FACL5; FACL5 for fatty acid coenzyme A ligase 5; fatty acid coenzyme A ligase 5; fatty acid Coenzyme A ligase, long chain 5; fatty-acid-Coenzyme A ligase, long-chain 5; HGNC:16526; LACS 5; Long-chain acyl-CoA synthetase 5; long-chain fatty acid coenzyme A ligase 5; long-chain-fatty-acid--CoA ligase 5; UNQ633/PRO1250; zgc:92083
• Host Species: Rabbit
• Purification Method: Antigen Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 433256, 51703, 94340
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: O88813, Q8JZR0, Q9ULC5
• Gene Symbols: ACSL5
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ACSL5 (337-378aa ADDMKTLKPTLFPAVPRLLNRIYDKVQNEAKTPLKKFLLKLA).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG