Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA578714

Invitrogen™ ACSL5 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA578714
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA578714 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA578714 Supplier Invitrogen™ Supplier No. PA578714
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat liver tissue, mouse liver tissue. Flow: HepG2 cell.

The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Antigen ACSL5
Applications Flow Cytometry, Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation Antibody with 0.9mg NaCl, 0.2mg Na2PO4, 4mg trehalose and 0.05mg sodium azide
Gene ACSL5
Gene Accession No. O88813, Q8JZR0, Q9ULC5
Gene Alias 1700030F05Rik; ACS2; ACS5; Acsl5; acyl-CoA synthetase 5; acyl-CoA synthetase long chain family member 5; acyl-CoA synthetase long-chain family member 5; Arachidonate--CoA ligase; FACL5; FACL5 for fatty acid coenzyme A ligase 5; fatty acid coenzyme A ligase 5; fatty acid Coenzyme A ligase, long chain 5; fatty-acid-Coenzyme A ligase, long-chain 5; HGNC:16526; LACS 5; Long-chain acyl-CoA synthetase 5; long-chain fatty acid coenzyme A ligase 5; long-chain-fatty-acid--CoA ligase 5; UNQ633/PRO1250; zgc:92083
Gene Symbols ACSL5
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human ACSL5 (337-378aa ADDMKTLKPTLFPAVPRLLNRIYDKVQNEAKTPLKKFLLKLA).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 433256, 51703, 94340
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.