Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ AFF4 Monoclonal Antibody (8G12)
GREENER_CHOICE

Catalog No. PIMA549267
Change view
Click to view available options
Quantity:
100 μg
Catalog No. Quantity
PIMA549267 100 μg
1 options

Catalog No. PIMA549267

Supplier: Invitrogen™ MA549267

Only null left
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Immunogen sequence is identical to the related mouse sequence. Positive Control - WB: human HELA whole cell, human HEPG2 whole cell, human CACO-2 whole cell, human HEK293 whole cell, human MDA-MB-453 whole cell, human PANC-1 whole cell, human SW620 whole cell. Flow: 293T cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The protein encoded by this gene belongs to the AF4 family of transcription factors involved in leukemia. It is a component of the positive transcription elongation factor b (P-TEFb) complex. A chromosomal translocation involving this gene and MLL gene on chromosome 11 is found in infant acute lymphoblastic leukemia with ins.
TRUSTED_SUSTAINABILITY

Specifications

Antigen AFF4
Applications Flow Cytometry, Western Blot
Classification Monoclonal
Clone 8G12
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene AFF4
Gene Accession No. Q9UHB7
Gene Alias AF4/FMR2 family member 4; AF4/FMR2 family, member 4; AF5Q31; Aff4; Alf4; ALL1 fused gene from 5q31; ALL1-fused gene from chromosome 5q31 protein; CHOPS; HSPC092; Laf4l; LOW QUALITY PROTEIN: AF4/FMR2 family member 4; major CDK9 elongation factor-associated protein; MCEF; Protein AF-5q31; RA_m002_jsmFBA6Br
Gene Symbols AFF4
Host Species Mouse
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human AFF4 (6-53aa RNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQ).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 27125
Target Species Human
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG2b
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.