Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA578749

Invitrogen™ AKAP2 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA578749
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA578749 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA578749 Supplier Invitrogen™ Supplier No. PA578749
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human PC-3 whole cell, mouse lung tissue.

Binds to regulatory subunit (RII) of protein kinase A. May be involved in establishing polarity in signaling systems or in integrating PKA-RII isoforms with downstream effectors to capture, amplify and focus diffuse, trans-cellular signals carried by cAMP. [UniProt].
TRUSTED_SUSTAINABILITY

Specifications

Antigen AKAP2
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene AKAP2
Gene Accession No. O54931, Q9Y2D5
Gene Alias A kinase (PRKA) anchor protein 2; AA959716; AI649048; AKAP expressed in kidney and lung; AKAP2; AKAP-2; AKAPKL; AKAP-KL; A-kinase anchor protein 2; A-kinase anchoring protein 2; B230340M18Rik; KL2B; MISP2; PALM2-AKAP2; PRKA2; protein kinase A anchoring protein 2; protein kinase A2; protein kinase A-anchoring protein 2
Gene Symbols AKAP2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human AKAP2 (813-852aa ETHKSKRRERMDDSSVLEATRVNRRKSALALRWEAGIYAN).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11217, 11641
Target Species Human, Mouse
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.