Invitrogen™ AKR1B10 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA578751

Catalog No. PIPA578751

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human A549 whole cell, human HepG2 whole cell. IHC: human intestinal cancer tissue, human liver cancer tissue. ICC/IF: A549 cell.

AKR1B10, a 316aa protein, catalyzes efficient reduction ofaliphatic and aromatic aldehydes. It the first cytosolic NADP (H)-dependent retinal reductase described in humans and is characterized by the presence of a novel NADP binding motif. Due to its ability to convert glucose to sorbitol, AKR1B10 may have a role in development of secondary diabetic complications.It is abundantly expressed in adrenal gland, small intestine and colon, with lower levels in liver, thymus, prostate, testis, and skeletal muscle and its levels are up regulated in certain cancers such as hepatocellular carcinoma.

Specifications

• Antigen: AKR1B10
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Akr1b10
• Gene Alias: 2310005E10Rik; AKR1B10; AKR1B11; AKR1B12; Akr1b16; aldo-keto reductase family 1 member B10; aldo-keto reductase family 1, member B10; aldo-keto reductase family 1, member B10 (aldose reductase); aldo-keto reductase family 1, member B11 (aldose reductase-like); Aldose reductase-like; aldose reductase-like 1; aldose reductase-like peptide; aldose reductase-related protein; ALDRLn; ARL1; ARL-1; ARP; hARP; HIS; HSI; MGC14103; SI reductase; small intestine reductase
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 57016
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: O60218
• Gene Symbols: Akr1b10
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human AKR1B10 (285-316aa EMATILSFNRNWRACNVLQSSHLEDYPFNAEY).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov