Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA578751

Invitrogen™ AKR1B10 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA578751
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA578751 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA578751 Supplier Invitrogen™ Supplier No. PA578751
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human A549 whole cell, human HepG2 whole cell. IHC: human intestinal cancer tissue, human liver cancer tissue. ICC/IF: A549 cell.

AKR1B10, a 316aa protein, catalyzes efficient reduction ofaliphatic and aromatic aldehydes. It the first cytosolic NADP (H)-dependent retinal reductase described in humans and is characterized by the presence of a novel NADP binding motif. Due to its ability to convert glucose to sorbitol, AKR1B10 may have a role in development of secondary diabetic complications.It is abundantly expressed in adrenal gland, small intestine and colon, with lower levels in liver, thymus, prostate, testis, and skeletal muscle and its levels are up regulated in certain cancers such as hepatocellular carcinoma.
TRUSTED_SUSTAINABILITY

Specifications

Antigen AKR1B10
Applications Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene Akr1b10
Gene Accession No. O60218
Gene Alias 2310005E10Rik; AKR1B10; AKR1B11; AKR1B12; Akr1b16; aldo-keto reductase family 1 member B10; aldo-keto reductase family 1, member B10; aldo-keto reductase family 1, member B10 (aldose reductase); aldo-keto reductase family 1, member B11 (aldose reductase-like); Aldose reductase-like; aldose reductase-like 1; aldose reductase-like peptide; aldose reductase-related protein; ALDRLn; ARL1; ARL-1; ARP; hARP; HIS; HSI; MGC14103; SI reductase; small intestine reductase
Gene Symbols Akr1b10
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human AKR1B10 (285-316aa EMATILSFNRNWRACNVLQSSHLEDYPFNAEY).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 57016
Target Species Human
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.