Novus Biologicals™ AKT1 Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AKT1. The AKT1 Recombinant Protein Antigen is derived from E. coli. The AKT1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-89159. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Specifications

• Gene ID (Entrez): 207
• Species: Human
• Purification Method: Chromatography
• Purity: >80%
• Concentration: 0.5mg/mL
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Formulation: PBS, 1M Urea, pH 7.4
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: AKT, AKT serine/threonine kinase 1, AKT1m, CWS6, EC 2.7.11, EC 2.7.11.1, PKB, PKB alpha, PKBMGC99656, PRKBA, Protein kinase B, Protein Kinase B Alpha, Proto-oncogene c-Akt, RAC, rac protein kinase alpha, RAC-ALPHA, RAC-alpha serine/threonine-protein kinase, RAC-PK-alpha, RACPKB-ALPHA, Serine-Threonine Protein Kinase, v-akt murine thymoma viral oncogene homolog 1, V-Akt Murine Thymoma Viral Oncogene-Like Protein 1
• Gene Symbol: AKT1
• Label Type: Unlabeled
• Molecular Weight (g/mol): 29kDa
• Product Type: Akt1
• Quantity: 0.1 mL
• Regulatory Status: RUO
• Source: E.Coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89159. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
• Storage Buffer: PBS, 1M Urea, pH 7.4
• Immunogen: ERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVA

For Research Use Only