Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Invitrogen™ ALDH7A1 Polyclonal Antibody
Rabbit Polyclonal Antibody
Supplier: Invitrogen™ PA578759
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HCCP tissue, rat liver tissue, mouse liver tissue. IHC: rat brain tissue, human lung cancer tissue. ICC/IF: U20S cell, U20S cell. Flow: A431 cell.
The protein encoded by this gene is a member of subfamily 7 in the aldehyde dehydrogenase gene family. These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This particular member has homology to a previously described protein from the green garden pea, the 26g pea turgor protein. It is also involved in lysine catabolism that is known to occur in the mitochondrial matrix. Recent reports show that this protein is found both in the cytosol and the mitochondria, and the two forms likely arise from the use of alternative translation initiation sites. An additional variant encoding a different isoform has also been found for this gene. Mutations in this gene are associated with pyridoxine-dependent epilepsy. Several related pseudogenes have also been identified.
Specifications
ALDH7A1 | |
Polyclonal | |
Unconjugated | |
ALDH7A1 | |
26g turgor protein homolog; Ald7a1; aldehyde dehydrogenase 7 family member A1; aldehyde dehydrogenase 7 family, member A1; aldehyde dehydrogenase family 7 member A1; aldehyde dehydrogenase family 7, member A1; Aldh7a1; Alpha-AASA dehydrogenase; alpha-aminoadipic semialdehyde dehydrogenase; antiquitin; Antiquitin 1; Antiquitin1; Antiquitin-1; ATQ1; Betaine aldehyde dehydrogenase; D18Wsu181e; delta1-piperideine-6-carboxylate dehydrogenase; delta1-piperideine-6-carboxylate dehydrogenease; EPD; P6c dehydrogenase; PDE | |
Rabbit | |
Antigen affinity chromatography | |
RUO | |
110695, 291450, 501 | |
-20°C | |
Lyophilized |
Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry | |
500 μg/mL | |
PBS with 5mg BSA and 0.05mg sodium azide | |
P49419, Q64057, Q9DBF1 | |
ALDH7A1 | |
A synthetic peptide corresponding to a sequence at the C-terminus of human ALDH7A1 (333-369aa ARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLY). | |
100 μg | |
Primary | |
Human, Mouse, Rat | |
Antibody | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction