Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA578759

Invitrogen™ ALDH7A1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA578759
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA578759 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA578759 Supplier Invitrogen™ Supplier No. PA578759
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HCCP tissue, rat liver tissue, mouse liver tissue. IHC: rat brain tissue, human lung cancer tissue. ICC/IF: U20S cell, U20S cell. Flow: A431 cell.

The protein encoded by this gene is a member of subfamily 7 in the aldehyde dehydrogenase gene family. These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This particular member has homology to a previously described protein from the green garden pea, the 26g pea turgor protein. It is also involved in lysine catabolism that is known to occur in the mitochondrial matrix. Recent reports show that this protein is found both in the cytosol and the mitochondria, and the two forms likely arise from the use of alternative translation initiation sites. An additional variant encoding a different isoform has also been found for this gene. Mutations in this gene are associated with pyridoxine-dependent epilepsy. Several related pseudogenes have also been identified.
TRUSTED_SUSTAINABILITY

Specifications

Antigen ALDH7A1
Applications Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene ALDH7A1
Gene Accession No. P49419, Q64057, Q9DBF1
Gene Alias 26g turgor protein homolog; Ald7a1; aldehyde dehydrogenase 7 family member A1; aldehyde dehydrogenase 7 family, member A1; aldehyde dehydrogenase family 7 member A1; aldehyde dehydrogenase family 7, member A1; Aldh7a1; Alpha-AASA dehydrogenase; alpha-aminoadipic semialdehyde dehydrogenase; antiquitin; Antiquitin 1; Antiquitin1; Antiquitin-1; ATQ1; Betaine aldehyde dehydrogenase; D18Wsu181e; delta1-piperideine-6-carboxylate dehydrogenase; delta1-piperideine-6-carboxylate dehydrogenease; EPD; P6c dehydrogenase; PDE
Gene Symbols ALDH7A1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human ALDH7A1 (333-369aa ARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLY).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 110695, 291450, 501
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.