Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA595365

Invitrogen™ AMACR Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595365
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595365 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595365 Supplier Invitrogen™ Supplier No. PA595365
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human 293T whole cell lysates, human LNCAP whole cell lysates, human HepG2 whole cell lysates, human Hela whole cell lysates, rat kidney tissue lysates, rat liver tissue lysates, mouse kidney tissue lysates, mouse liver tissue lysates. IHC: human stomach cancer tissue, mouse kidney tissue, rat kidney tissue. ICC/IF: U2OS cell. Flow: HepG2 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

P504S/AMACR/a-Methylacyl-CoA Racemase is an essential enzyme in the b-oxidation of branched-chain fatty acids. High expression of P504S protein is found in prostatic adenocarcinoma but not in benign prostate tissue by immunohistochemical staining in paraffin-embedded tissue. The expression of P504S is also detected in two premalignant lesions of the prostate: high-grade prostatic intraepithelial neoplasia (PIN) and atypical adenomatous hyperplasia.
TRUSTED_SUSTAINABILITY

Specifications

Antigen AMACR
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene AMACR
Gene Accession No. O09174, P70473, Q9UHK6
Gene Alias 2-arylpropionyl-CoA epimerase; 2-methylacyl-CoA racemase; Alpha-methylacyl-CoA racemase; alpha-methylacyl-Coenzyme A racemase; Amacr; AMACRD; amcr; CBAS4; Da1-8; Macr1; Marc1; OTTHUMP00000219978; OTTHUMP00000219979; RACE; RM
Gene Symbols AMACR
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human AMACR (208-246aa RGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIK).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 17117, 23600, 25284
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.