CPC Scientific H-Asp-Ala-Glu-Phe-Arg-Arg-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH (trifluoroacetate salt) 1MG

Supplier:  CPC Scientific AMYD050B

This peptide is the English (H6R) mutation of beta-amyloid, which accelerates fibrillation without increasing protofibril formation. The English and Tottori mutations alter Abeta assembly at its earliest stages, monomer folding and oligomerization, and produce oligomers that are more toxic to cultured neuronal cells than are wild type oligomers. The exchange of His6 by Arg influences the structure of the Cu2+ complex formed by Abeta peptides.ONE-LETTER SEQUENCE: DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVMOLECULAR FORMULA: C194H300N54O58S1MOLECULAR WEIGHT:4348.91STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [1802084-26-9], SYNONYMS: [Arg6]-beta-Amyloid (1-40), England MutationRESEARCH AREA: Alzheimer's DiseaseREFERENCES: Y.Hori et al., J. Biol. Chem., 282, 4916 (2007); K.Ono et al., J. Biol. Chem., 285, 23186 (2010); B.Alies et al., Inorg. Chem., 50, 11192 (2011)

Catalog No. 50-210-8711