ADORA3, Mouse, Clone: 1A3, Abnova™

Catalog No.	Quantity
89-016-057	100 μg

Catalog No. 89-016-057 Supplier Abnova Corporation Supplier No. H00000140M01

Description

Mouse monoclonal antibody raised against a partial recombinant ADORA3.

This gene encodes a protein that belongs to the family of adenosine receptors, which are G-protein-coupled receptors that are involved in a variety of intracellular signaling pathways and physiological functions. The receptor encoded by this gene mediates a sustained cardioprotective function during cardiac ischemia, it is involved in the inhibition of neutrophil degranulation in neutrophil-mediated tissue injury, it has been implicated in both neuroprotective and neurodegenerative effects, and it may also mediate both cell proliferation and cell death. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYFSFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGRE

Specifications

• Antigen: ADORA3
• Applications: ELISA
• Classification: Monoclonal
• Clone: 1A3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ADORA3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ADORA3
• Gene Accession No.: BC029831
• Gene Alias: A3AR/AD026/bA552M11.5
• Gene Symbols: ADORA3
• Host Species: Mouse
• Immunogen: ADORA3 (AAH29831, 121 a.a. ∼ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 140
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ