ADORA3, Mouse, Clone: 1A3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ADORA3.

Supplier:  Abnova Corporation H00000140M01

Catalog No. 89-016-057

Description

This gene encodes a protein that belongs to the family of adenosine receptors, which are G-protein-coupled receptors that are involved in a variety of intracellular signaling pathways and physiological functions. The receptor encoded by this gene mediates a sustained cardioprotective function during cardiac ischemia, it is involved in the inhibition of neutrophil degranulation in neutrophil-mediated tissue injury, it has been implicated in both neuroprotective and neurodegenerative effects, and it may also mediate both cell proliferation and cell death. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYFSFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGRE

Specifications

• Antigen: ADORA3
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC029831
• Gene Symbols: ADORA3
• Immunogen: ADORA3 (AAH29831, 121 a.a. ∼ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b κ

• Applications: ELISA
• Clone: 1A3
• Description: Mouse monoclonal antibody raised against a partial recombinant ADORA3.
• Gene: ADORA3
• Gene Alias: A3AR/AD026/bA552M11.5
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 140
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid