aldo-keto reductase family 1, member B1 (aldose reductase), Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human AKR1B1 protein.

Supplier:  Abnova Corporation H00000231D01P

Catalog No. 89-017-987

Description

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. Multiple pseudogenes have been identified for this gene. The nomenclature system used by the HUGO Gene Nomenclature Committee to define human aldo-keto reductase family members is known to differ from that used by the Mouse Genome Informatics database. [provided by RefSeq

Sequence: MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF

Specifications

• Antigen: aldo-keto reductase family 1, member B1 (aldose reductase)
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human AKR1B1 protein.
• Gene: AKR1B1
• Gene Alias: ADR/ALDR1/ALR2/AR/MGC1804
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001628
• Gene Symbols: AKR1B1
• Immunogen: AKR1B1 (NP_001619.1, 1 a.a. ∼ 316 a.a) full-length human protein.
• Quantity: 100 μg
• Research Discipline: Stem Cell Biology
• Gene ID (Entrez): 231
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG