Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AMFR, Mouse, Clone: 3D9, Abnova™

Catalog No. 89016137 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-016-137 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-016-137 Supplier Abnova Corporation Supplier No. H00000267M01
Only null left
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant AMFR.

Autocrine motility factor is a tumor motility-stimulating protein secreted by tumor cells. The protein encoded by this gene is a glycosylated transmembrane protein and a receptor for autocrine motility factor. The receptor, which shows some sequence similarity to tumor protein p53, is localized to the leading and trailing edges of carcinoma cells. [provided by RefSeq

Sequence: QASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPFPTQRSDSIRPALNSPVERPSSDQEEGETSAQTERVPLDLSPRLEETLD

Specifications

Antigen AMFR
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3D9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant AMFR.
Formulation PBS with no preservative; pH 7.4
Gene AMFR
Gene Accession No. NM_001144
Gene Alias GP78/RNF45
Gene Symbols AMFR
Host Species Mouse
Immunogen AMFR (NP_001135, 451 a.a. ∼ 550 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 267
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.