Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AMPD2, Mouse, Clone: 2G8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant AMPD2.

Manufacturer:  Abnova Corporation H00000271M04A

Catalog No. 89-016-140


  Check Availability
Add to cart

Specifications

Description

Adenosine monophosphate deaminase-2 (EC 3.5.4.6) catalyzes the deamination of AMP to IMP and plays an important role in the purine nucleotide cycle.[supplied by OMIM

Sequence: ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTT
Description & Specifications

Specifications

AMPD2
2G8
Human
Ascites
AMPD2
AMPD2
AMPD2 (NP_631895, 86 a.a. ∽186 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa.
200μL
Human
Primary
271
ELISA,Western Blot
Unlabeled
adenosine monophosphate deaminase 2 (isoform L)
In ascites fluid
NM_139156
Murine
IgG2a, κ
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit