ATF4, Mouse, Clone: 2E3, Abnova™

Catalog No.	Quantity
89-016-237	100 μg

Catalog No. 89-016-237 Supplier Abnova Corporation Supplier No. H00000468M07

Description

Mouse monoclonal antibody raised against a full-length recombinant ATF4.

This gene encodes a transcription factor that was originally identified as a widely expressed mammalian DNA binding protein that could bind a tax-responsive enhancer element in the LTR of HTLV-1. The encoded protein was also isolated and characterized as the cAMP-response element binding protein 2 (CREB-2). The protein encoded by this gene belongs to a family of DNA-binding proteins that includes the AP-1 family of transcription factors, cAMP-response element binding proteins (CREBs) and CREB-like proteins. These transcription factors share a leucine zipper region that is involved in protein-protein interactions, located C-terminal to a stretch of basic amino acids that functions as a DNA binding domain. Two alternative transcripts encoding the same protein have been described. Two pseudogenes are located on the X chromsome at q28 in a region containing a large inverted duplication. [provided by RefSeq

Sequence: MTEMSFLSSEVLVGDLMSPFDPSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPPPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP

Specifications

• Antigen: ATF4
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2E3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant ATF4.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ATF4
• Gene Accession No.: BC008090
• Gene Alias: CREB-2/CREB2/TAXREB67/TXREB
• Gene Symbols: ATF4
• Host Species: Mouse
• Immunogen: ATF4 (AAH08090, 1 a.a. ∼ 351 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 468
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ