ATP5I, Mouse, Clone: 1E6, Abnova™

Catalog No.	Quantity
89-016-275	100 μg

Catalog No. 89-016-275 Supplier Abnova Corporation Supplier No. H00000521M01

Description

Mouse monoclonal antibody raised against a full-length recombinant ATP5I.

Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, F0, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The F0 seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the e subunit of the F0 complex. [provided by RefSeq

Sequence: MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK

Specifications

• Antigen: ATP5I
• Applications: ELISA
• Classification: Monoclonal
• Clone: 1E6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant ATP5I.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ATP5I
• Gene Accession No.: BC003679
• Gene Alias: ATP5K/MGC12532
• Gene Symbols: ATP5I
• Host Species: Mouse
• Immunogen: ATP5I (AAH03679, 1 a.a. ∼ 69 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 521
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ