HLA-B associated transcript 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant BAT1.

Manufacturer:  Abnova Corporation H00007919A01

Catalog No. 89-004-372

Description

This gene encodes a member of the DEAD box family of RNA-dependent ATPases that mediate ATP hydrolysis during pre-mRNA splicing. The encoded protein is an essential splicing factor required for association of U2 small nuclear ribonucleoprotein with pre-mRNA, and also plays an important role in mRNA export from the nucleus to the cytoplasm. A cluster of genes, BAT1-BAT5, is localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. Mutations in this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq

Sequence: RYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR

Specifications

• Antigen: HLA-B associated transcript 1
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_004640
• Gene Alias: D6S81E|DDX39B|UAP56
• Host Species: Mouse
• Quantity: 50 uL
• Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Primary or Secondary: Primary
• Gene ID (Entrez): 7919

• Applications: ELISA, Western Blot
• Description: Mouse polyclonal antibody raised against a partial recombinant BAT1.
• Gene: BAT1
• Format: Serum
• Gene Symbols: BAT1
• Immunogen: BAT1 (NP_004631, 329 a.a. ~ 428 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Y
• Monoclonal or Polyclonal: Polyclonal
• Target Species: Human