HLA-B associated transcript 1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-372	50 μL

Catalog No. 89-004-372 Supplier Abnova Corporation Supplier No. H00007919A01

Description

Mouse polyclonal antibody raised against a partial recombinant BAT1.

This gene encodes a member of the DEAD box family of RNA-dependent ATPases that mediate ATP hydrolysis during pre-mRNA splicing. The encoded protein is an essential splicing factor required for association of U2 small nuclear ribonucleoprotein with pre-mRNA, and also plays an important role in mRNA export from the nucleus to the cytoplasm. A cluster of genes, BAT1-BAT5, is localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. Mutations in this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq

Sequence: RYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR

Specifications

• Antigen: HLA-B associated transcript 1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant BAT1.
• Formulation: 50% glycerol
• Gene: BAT1
• Gene Accession No.: NM_004640
• Gene Alias: D6S81E/DDX39B/UAP56
• Gene Symbols: BAT1
• Host Species: Mouse
• Immunogen: BAT1 (NP_004631, 329 a.a. ∼ 428 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 7919
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum