bromodomain adjacent to zinc finger domain, 1B, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant BAZ1B.

Supplier:  Abnova Corporation H00009031A01

Catalog No. 89-004-417

Description

This gene encodes a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. [provided by RefSeq

Sequence: MDFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQKK

Specifications

• Antigen: bromodomain adjacent to zinc finger domain, 1B
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant BAZ1B.
• Gene: BAZ1B
• Gene Alias: WBSCR10/WBSCR9/WSTF
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_023005
• Gene Symbols: BAZ1B
• Immunogen: BAZ1B (NP_075381, 1384 a.a. ∼ 1483 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 9031
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.