BMP2 inducible kinase, Mouse, Clone: 1F11, Abnova™

Catalog No.	Quantity
89-001-307	100 μg

Catalog No. 89-001-307 Supplier Abnova Corporation Supplier No. H00055589M02

Description

Mouse monoclonal antibody raised against a partial recombinant BMP2K.

This gene is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. Expression of the mouse gene is increased during BMP-2 induced differentiation and the gene product is a putative serine/threonine protein kinase containing a nuclear localization signal. Therefore, the protein encoded by this human homolog is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: YQQAFFQQQMLAQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSVADKEAIANFTNQKNISNPPDMSGWNPFGEDNFSKLTEEELLDREFDLLRS

Specifications

• Antigen: BMP2 inducible kinase
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1F11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant BMP2K.
• Formulation: PBS with no preservative; pH 7.4
• Gene: BMP2K
• Gene Accession No.: BC036021
• Gene Alias: BIKE/DKFZp434K0614/DKFZp434P0116/HRIHFB2017
• Gene Symbols: BMP2K
• Host Species: Mouse
• Immunogen: BMP2K (AAH36021, 540 a.a. ∼ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 55589
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ