CALML3, Mouse, Clone: 2A11, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant CALML3.

Supplier:  Abnova Corporation H00000810M04

Catalog No. 89-016-411

Description

Sequence: MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK

Specifications

• Antigen: CALML3
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC031889
• Gene Symbols: CALML3
• Immunogen: CALML3 (AAH31889, 1 a.a. ∼ 149 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b κ

• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 2A11
• Description: Mouse monoclonal antibody raised against a full-length recombinant CALML3.
• Gene: CALML3
• Gene Alias: CLP
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 810
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid