cadherin 19, type 2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-601	50 μL

Catalog No. 89-004-601 Supplier Abnova Corporation Supplier No. H00028513A01

Description

Mouse polyclonal antibody raised against a partial recombinant CDH19.

This gene is a type II classical cadherin from the cadherin superfamily and one of three cadherin 7-like genes located in a cluster on chromosome 18. The encoded membrane protein is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. Since disturbance of intracellular adhesion is a prerequisite for invasion and metastasis of tumor cells, cadherins are considered prime candidates for tumor suppressor genes. [provided by RefSeq

Sequence: GQPGALSGTTSVLIKLSDVNDNKPIFKESLYRLTVSESAPTGTSIGTIMAYDNDIGENAEMDYSIEEDDSQTFDIITNHETQEGIVILKKKVDFEHQNHYGIRAKVKNHH

Specifications

• Antigen: cadherin 19, type 2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CDH19.
• Formulation: 50% glycerol
• Gene: CDH19
• Gene Accession No.: NM_021153
• Gene Alias: CDH7/CDH7L2
• Gene Symbols: CDH19
• Host Species: Mouse
• Immunogen: CDH19 (NP_066976, 231 a.a. ∼ 340 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 28513
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum