CCAAT/enhancer binding protein (C/EBP), epsilon, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-060	50 μL

Catalog No. 89-004-060 Supplier Abnova Corporation Supplier No. H00001053A01

Description

Mouse polyclonal antibody raised against a full-length recombinant CEBPE.

The protein encoded by this gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-delta. The encoded protein may be essential for terminal differentiation and functional maturation of committed granulocyte progenitor cells. Mutations in this gene have been associated with Specific Granule Deficiency, a rare congenital disorder. Multiple variants of this gene have been described, but the full-length nature of only one has been determined. [provided by RefSeq

Sequence: MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS

Specifications

• Antigen: CCAAT/enhancer binding protein (C/EBP), epsilon
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length recombinant CEBPE.
• Formulation: 50% glycerol
• Gene: CEBPE
• Gene Accession No.: BC035797
• Gene Alias: C/EBP-epsilon/CRP1
• Gene Symbols: CEBPE
• Host Species: Mouse
• Immunogen: CEBPE (AAH35797.2, 1 a.a. ∼ 281 a.a) full-length recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 1053
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum