Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001130

cerberus 1, cysteine knot superfamily, homolog (Xenopus laevis), Mouse, Clone: 3E11, Abnova™

Catalog No. 89001130 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-130 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-130 Supplier Abnova Corporation Supplier No. H00009350M04
Only null left
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant CER1.

This gene encodes a cytokine member of the cysteine knot superfamily, characterized by nine conserved cysteines and a cysteine knot region. The cerberus-related cytokines, together with Dan and DRM/Gremlin, represent a group of bone morphogenetic protein (BMP) antagonists that can bind directly to BMPs and inhibit their activity. [provided by RefSeq

Sequence: HWETCRTVPFSQTITHEGCEKVVVQNNLCFGKCGSVHFPGAAQHSHTSCSHCLPAKFTTMHLPLNCTELSSVIKVVMLVEECQCKVKTEHEDGHILHAGSQDSFIPGVS

Specifications

Antigen cerberus 1, cysteine knot superfamily, homolog (Xenopus laevis)
Applications ELISA, Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 3E11
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant CER1.
Formulation PBS with no preservative; pH 7.4
Gene CER1
Gene Accession No. NM_005454
Gene Alias DAND4/MGC119894/MGC119895/MGC96951
Gene Symbols CER1
Host Species Mouse
Immunogen CER1 (NP_005445.1, 158 a.a. ∼ 266 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Stem Cell Biology
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 9350
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.