CREBL1, Mouse, Clone: 4D10, Abnova™

Catalog No.	Quantity
89-021-160	100 μg

Catalog No. 89-021-160 Supplier Abnova Corporation Supplier No. H00001388M02

Description

Mouse monoclonal antibody raised against a partial recombinant CREBL1.

The protein encoded by this gene is a transcription factor in the unfolded protein response (UPR) pathway during ER stress. Either as a homodimer or as a heterodimer with ATF6-alpha, the encoded protein binds to the ER stress response element, interacting with nuclear transcription factor Y to activate UPR target genes. The protein is normally found in the membrane of the endoplasmic reticulum; however, under ER stress, the N-terminal cytoplasmic domain is cleaved from the rest of the protein and translocates to the nucleus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: AELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDGSSLDVGMDVSPSEPPWELLPIFPDLQVK

Specifications

• Antigen: CREBL1
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 4D10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CREBL1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ATF6B
• Gene Accession No.: NM_004381
• Gene Alias: CREB-RP/CREBL1/FLJ10066/G13
• Gene Symbols: ATF6B
• Host Species: Mouse
• Immunogen: CREBL1 (NP_004372.3, 2 a.a. ∼ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1388
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ