cysteine and glycine-rich protein 1, Mouse, Clone: 2A11, Abnova™

Catalog No.	Quantity
89-000-596	100 μg

Catalog No. 89-000-596 Supplier Abnova Corporation Supplier No. H00001465M06

Description

Mouse monoclonal antibody raised against a partial recombinant CSRP1.

This gene encodes a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this gene product occurs in proteins with critical functions in gene regulation, cell growth, and somatic differentiation. [provided by RefSeq

Sequence: EAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHS

Specifications

• Antigen: cysteine and glycine-rich protein 1
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 2A11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CSRP1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CSRP1
• Gene Accession No.: NM_004078
• Gene Alias: CRP/CRP1/CSRP/CYRP/D1S181E/DKFZp686M148
• Gene Symbols: CSRP1
• Host Species: Mouse
• Immunogen: CSRP1 (NP_004069, 94 a.a. ∼ 192 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 1465
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ