defensin, alpha 6, Paneth cell-specific, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-017-561	100 μg

Catalog No. 89-017-561 Supplier Abnova Corporation Supplier No. H00001671D01P

Description

Rabbit polyclonal antibody raised against a full-length human DEFA6 protein.

Defensins are a family of microbicidal and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 6, is highly expressed in the secretory granules of Paneth cells of the small intestine, and likely plays a role in host defense of human bowel. [provided by RefSeq

Sequence: MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL

Specifications

• Antigen: defensin, alpha 6, Paneth cell-specific
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against a full-length human DEFA6 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: DEFA6
• Gene Accession No.: NM_001926.2
• Gene Alias: DEF6/HD-6
• Gene Symbols: DEFA6
• Host Species: Rabbit
• Immunogen: DEFA6 (NP_001917.1, 1 a.a. ∼ 100 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1671
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG