DHX9, Mouse, Clone: 3G7, Abnova™

Catalog No.	Quantity
89-021-288	100 μg

Catalog No. 89-021-288 Supplier Abnova Corporation Supplier No. H00001660M01

Description

Mouse monoclonal antibody raised against a partial recombinant DHX9.

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression. It contains 2 copies of a double-stranded RNA-binding domain, a DEXH core domain and an RGG box. The RNA-binding domains and RGG box influence and regulate RNA helicase activity. [provided by RefSeq

Sequence: MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP

Specifications

• Antigen: DHX9
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 3G7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant DHX9.
• Formulation: PBS with no preservative; pH 7.4
• Gene: DHX9
• Gene Accession No.: NM_001357
• Gene Alias: DDX9/LKP/NDHII/RHA
• Gene Symbols: DHX9
• Host Species: Mouse
• Immunogen: DHX9 (NP_001348, 1 a.a. ∼ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1660
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ