DSCR1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length recombinant DSCR1.

Supplier:  Abnova Corporation H00001827A02

Catalog No. 89-003-262

Description

The protein encoded by this gene interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. This gene is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of this gene may lead to neurofibrillary tangles such as those associated with Alzheimer disease. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq

Sequence: MEEVDLRDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTQIHLS

Specifications

• Antigen: DSCR1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length recombinant DSCR1.
• Gene: RCAN1
• Gene Alias: ADAPT78/CSP1/DSC1/DSCR1/MCIP1/RCN1
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: ELISA
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: BC002864
• Gene Symbols: RCAN1
• Immunogen: DSCR1 (AAH02864, 1 a.a. ∼ 197 a.a) full-length recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 1827
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.