endothelial differentiation-related factor 1 (B02), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-006-627	50 μL

Catalog No. 89-006-627 Supplier Abnova Corporation Supplier No. H00008721B02

Description

Mouse polyclonal antibody raised against a full-length human EDF1 protein.

This gene encodes a protein that may regulate endothelial cell differentiation. It has been postulated that the protein functions as a bridging molecule that interconnects regulatory proteins and the basal transcriptional machinery, thereby modulating the transcription of genes involved in endothelial differentiation. This protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Two alternatively spliced transcripts which encode distinct proteins have been found for this gene. [provided by RefSeq

Sequence: MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK

Specifications

• Antigen: endothelial differentiation-related factor 1
• Applications: Immunofluorescence, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human EDF1 protein.
• Formulation: No additive
• Gene: EDF1
• Gene Accession No.: NM_003792.2
• Gene Alias: EDF-1/MBF1/MGC9058
• Gene Symbols: EDF1
• Host Species: Mouse
• Immunogen: EDF1 (NP_003783.1, 1 a.a. ∼ 148 a.a) full-length human protein.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 8721
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum