ELA2 (M06J), Mouse anti-Human, Clone: 3B1, Abnova™

Catalog No.	Quantity
89-021-422	100 μg

Catalog No. 89-021-422 Supplier Abnova Corporation Supplier No. H00001991M06J

Description

Mouse monoclonal antibody raised against a partial recombinant ELA2.

Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins. The product of this gene hydrolyzes proteins within specialized neutrophil lysosomes, called azurophil granules, as well as proteins of the extracellular matrix following the protein's release from activated neutrophils. The enzyme may play a role in degenerative and inflammatory diseases by its proteolysis of collagen-IV and elastin of the extracellular matrix. This protein degrades the outer membrane protein A (OmpA) of E. coli as well as the virulence factors of such bacteria as Shigella, Salmonella and Yersinia. Mutations in this gene are associated with cyclic neutropenia and severe congenital neutropenia (SCN). This gene is clustered with other serine protease gene family members, azurocidin 1 and proteinase 3 genes, at chromosome 19pter. All 3 genes are expressed coordinately and their protein products are packaged together into azurophil granules during neutrophil differentiation. [provided by RefSeq]

Sequence: VLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH

Specifications

• Antigen: ELA2
• Applications: ELISA
• Classification: Monoclonal
• Clone: 3B1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ELA2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ELA2
• Gene Accession No.: NM_001972
• Gene Alias: GE/HLE/HNE/NE/PMN-E
• Gene Symbols: ELA2
• Host Species: Mouse
• Immunogen: ELA2 (NP_001963, 168 a.a. ∼ 267 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1991
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ