erythrocyte membrane protein band 4.1 like 4A, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human EPB41L4A protein.

Supplier:  Abnova Corporation H00064097B01

Catalog No. 89-008-052

Description

Members of the band 4.1 protein superfamily, including EPB41L4A, are thought to regulate the interaction between the cytoskeleton and plasma membrane (Ishiguro et al., 2000 [PubMed 10874211]).[supplied by OMIM

Sequence: MGCFCAVPEEFYCEVLLLDESKLTLTTQQQGIKKSTKGSVVLDHVFHHVNLVEIDYFGLRYCDRSHQTYWLDPAKTLAEHKELINTGPPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVKQDVLQGRLPCPVNTAAQLGAYAIQSELGDYDPYKHTAGYVSEYRFVPDQKEELEEAIERIHKTLM

Specifications

• Antigen: erythrocyte membrane protein band 4.1 like 4A
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human EPB41L4A protein.
• Gene: EPB41L4A
• Gene Alias: EPB41L4/FLJ38738/NBL4
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Cell Adhesion
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: BC031042.1
• Gene Symbols: EPB41L4A
• Immunogen: EPB41L4A (AAH31042.1, 1 a.a. ∼ 185 a.a) full-length human protein.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 64097
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.