FADD, Mouse, Clone: 3C3, Abnova™

Catalog No.	Quantity
89-002-733	100 μg

Catalog No. 89-002-733 Supplier Abnova Corporation Supplier No. H00008772M02

Description

Mouse monoclonal antibody raised against a partial recombinant FADD.

The protein encoded by this gene is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. Through its C-terminal death domain, this protein can be recruited by TNFRSF6/Fas-receptor, tumor necrosis factor receptor, TNFRSF25, and TNFSF10/TRAIL-receptor, and thus it participates in the death signaling initiated by these receptors. Interaction of this protein with the receptors unmasks the N-terminal effector domain of this protein, which allows it to recruit caspase-8, and thereby activate the cysteine protease cascade. Knockout studies in mice also suggest the importance of this protein in early T cell development. [provided by RefSeq

Sequence: GKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS

Specifications

• Antigen: FADD,
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3C3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant FADD.
• Formulation: PBS with no preservative; pH 7.4
• Gene: FADD
• Gene Accession No.: BC000334
• Gene Alias: GIG3/MGC8528/MORT1
• Gene Symbols: FADD
• Host Species: Mouse
• Immunogen: FADD (AAH00334, 109 a.a. ∼ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 8772
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 λ