fukutin, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-123	50 μL

Catalog No. 89-004-123 Supplier Abnova Corporation Supplier No. H00002218A01

Description

Mouse polyclonal antibody raised against a partial recombinant FCMD.

The protein encoded by this gene is a putative transmembrane protein that is localized to the cis-Golgi compartment, where it may be involved in the glycosylation of alpha-dystroglycan in skeletal muscle. The encoded protein is thought to be a glycosyltransferase and could play a role in brain development. Defects in this gene are a cause of Fukuyama-type congenital muscular dystrophy (FCMD), Walker-Warburg syndrome (WWS), limb-girdle muscular dystrophy type 2M (LGMD2M), and dilated cardiomyopathy type 1X (CMD1X). Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq

Sequence: KHYLSTKNGAGLSKSKGSRIGFDSTQWRAVKKFIMLTSNQNVPVFLIDPLILELINKNFEQVKNTSHGSTSQCKFFCVPRDFTAFALQYHLWKNEEGWFRIAENMGFQCL

Specifications

• Antigen: fukutin
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant FCMD.
• Formulation: 50% glycerol
• Gene: FKTN
• Gene Accession No.: NM_006731
• Gene Alias: CMD1X/FCMD/LGMD2M/MGC126857/MGC134944/MGC134945/MGC138243
• Gene Symbols: FKTN
• Host Species: Mouse
• Immunogen: FCMD (NP_006722, 29 a.a. ∼ 138 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Neurobiology
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 2218
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum