glucosidase, beta; acid (includes glucosylceramidase), Mouse, Clone: 2E2, Abnova™

Catalog No.	Quantity
89-015-829	100 μg

Catalog No. 89-015-829

Supplier: Abnova Corporation H00002629M01

Description

Mouse monoclonal antibody raised against a partial recombinant GBA.

This gene encodes a lysosomal membrane protein that cleaves the beta-glucosidic linkage of glycosylceramide, an intermediate in glycolipid metabolism. Mutations in this gene cause Gaucher disease, a lysosomal storage disease characterized by an accumulation of glucocerebrosides. A related pseudogene is approximately 12kb downstream of this gene on chromosome 1. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq

Sequence: SYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGS

Specifications

• Antigen: glucosidase, beta; acid (includes glucosylceramidase)
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 2E2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant GBA.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GBA
• Gene Accession No.: NM_000157
• Gene Alias: GBA1/GCB/GLUC
• Gene Symbols: GBA
• Host Species: Mouse
• Immunogen: GBA (NP_000148, 146 a.a. ∼ 235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2629
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ