Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89022325

GLRA1, Mouse, Clone: 2G4, Abnova™

Catalog No. 89022325 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-022-325 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-022-325 Supplier Abnova Corporation Supplier No. H00002741M04
Only null left
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant GLRA1.

The protein encoded by this gene is a subunit of a pentameric inhibitory glycine receptor. The receptor mediates postsynaptic inhibition in the central nervous system. Defects in this gene are a cause of startle disease (STHE), also known as hereditary hyperekplexia or congenital stiff-person syndrome. Two transcript variants encoding different isoforms have been found for this gene

Sequence: IWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEE

Specifications

Antigen GLRA1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2G4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant GLRA1.
Formulation PBS with no preservative; pH 7.4
Gene GLRA1
Gene Accession No. NM_000171
Gene Alias MGC138878/MGC138879/STHE
Gene Symbols GLRA1
Host Species Mouse
Immunogen GLRA1 (NP_000162, 121 a.a. ∼ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2741
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.