Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89017075

glutaredoxin 2, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No. 89017075 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-017-075 50 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-017-075 Supplier Abnova Corporation Supplier No. H00051022B01P
Only null left
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a full-length human GLRX2 protein.

Glutaredoxins (e.g., GLRX; MIM 600443) are a family of glutathione-dependent hydrogen donors that participate in a variety of cellular redox reactions.[supplied by OMIM

Sequence: MESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ

Specifications

Antigen glutaredoxin 2
Applications Immunofluorescence, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a full-length human GLRX2 protein.
Formulation PBS with no preservative; pH 7.4
Gene GLRX2
Gene Accession No. BC028113
Gene Alias GRX2/bA101E13.1
Gene Symbols GLRX2
Host Species Mouse
Immunogen GLRX2 (AAH28113, 1 a.a. ∼ 124 a.a) full-length human protein.
Purification Method Affinity Purified
Quantity 50 μg
Regulatory Status RUO
Research Discipline Apoptosis
Primary or Secondary Primary
Gene ID (Entrez) 51022
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.