glutaredoxin 2, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human GLRX2 protein.

Supplier:  Abnova Corporation H00051022B01P

Catalog No. 89-017-075

Description

Glutaredoxins (e.g., GLRX; MIM 600443) are a family of glutathione-dependent hydrogen donors that participate in a variety of cellular redox reactions.[supplied by OMIM

Sequence: MESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ

Specifications

• Antigen: glutaredoxin 2
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human GLRX2 protein.
• Gene: GLRX2
• Gene Alias: GRX2/bA101E13.1
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: Immunofluorescence, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC028113
• Gene Symbols: GLRX2
• Immunogen: GLRX2 (AAH28113, 1 a.a. ∼ 124 a.a) full-length human protein.
• Quantity: 50 μg
• Research Discipline: Apoptosis
• Gene ID (Entrez): 51022
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG