GRN, Mouse, Clone: 1A8, Abnova™

Catalog No.	Quantity
89-022-388	100 μg

Catalog No. 89-022-388 Supplier Abnova Corporation Supplier No. H00002896M02

Description

Mouse monoclonal antibody raised against a partial recombinant GRN.

Granulins are a family of secreted, glycosylated peptides that are cleaved from a single precursor protein with 7.5 repeats of a highly conserved 12-cysteine granulin/epithelin motif. The 88kDa precursor protein, progranulin, is also called proepithelin and PC cell-derived growth factor. Cleavage of the signal peptide produces mature granulin which can be further cleaved into a variety of active, 6kDa peptides. These smaller cleavage products are named granulin A, granulin B, granulin C, etc. Epithelins 1 and 2 are synonymous with granulins A and B, respectively. Both the peptides and intact granulin protein regulate cell growth. However, different members of the granulin protein family may act as inhibitors, stimulators, or have dual actions on cell growth. Granulin family members are important in normal development, wound healing, and tumorigenesis. [provided by RefSeq

Sequence: SCEKEVVSAQPATFLARSPHVAVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL

Specifications

• Antigen: GRN
• Applications: ELISA
• Classification: Monoclonal
• Clone: 1A8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant GRN.
• Formulation: In 1X PBS, pH 7.4
• Gene: GRN
• Gene Accession No.: NM_002087
• Gene Alias: GEP/GP88/PCDGF/PEPI/PGRN
• Gene Symbols: GRN
• Host Species: Mouse
• Immunogen: GRN (NP_002078, 494 a.a. ∼ 593 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2896
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG2a κ