general transcription factor IIH, polypeptide 2, 44kDa, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-005-487	50 μL

Catalog No. 89-005-487 Supplier Abnova Corporation Supplier No. H00002966B01

Description

Mouse polyclonal antibody raised against a full-length human GTF2H2 protein.

This gene is part of a 500kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. This gene is within the telomeric copy of the duplication. Deletion of this gene sometimes accompanies deletion of the neighboring SMN1 gene in spinal muscular atrophy (SMA) patients but it is unclear if deletion of this gene contributes to the SMA phenotype. This gene encodes the 44kDa subunit of RNA polymerase II transcription initiation factor IIH which is involved in basal transcription and nucleotide excision repair. Transcript variants for this gene have been described, but their full length nature has not been determined. A second copy of this gene within the centromeric copy of the duplication has been described in the literature. It is reported to be different by either two or four base pairs; however, no sequence data is currently available for the centromeric copy of the gene. [provided by RefSeq

Sequence: MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV

Specifications

• Antigen: general transcription factor IIH, polypeptide 2, 44kDa
• Applications: Immunofluorescence, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human GTF2H2 protein.
• Formulation: No additive
• Gene: GTF2H2
• Gene Accession No.: NM_001515.2
• Gene Alias: BTF2/BTF2P44/MGC102806/T-BTF2P44/TFIIH
• Gene Symbols: GTF2H2
• Host Species: Mouse
• Immunogen: GTF2H2 (NP_001506.1, 1 a.a. ∼ 395 a.a) full-length human protein.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Stem Cell Biology
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 2966
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum