histidyl-tRNA synthetase 2, mitochondrial (putative), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-561	50 μL

Catalog No. 89-004-561 Supplier Abnova Corporation Supplier No. H00023438A01

Description

Mouse polyclonal antibody raised against a partial recombinant HARSL.

Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene is an enzyme belonging to the class II family of aminoacyl-tRNA synthetases. Functioning in the synthesis of histidyl-transfer RNA, the enzyme plays an accessory role in the regulation of protein biosynthesis. The gene is located in a head-to-head orientation with HARS on chromosome five, where the homologous genes share a bidirectional promoter. [provided by RefSeq

Sequence: PLLGLLPRRAWASLLSQLLRPPCASCTGAVRCQSQVAEAVLTSQLKAHQEKPNFIIKTPKGTRDLSPQHMVVREKILDLVISCFKRHGAKGMDTPAFELKETLTEKYGE

Specifications

• Antigen: histidyl-tRNA synthetase 2, mitochondrial (putative)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant HARSL.
• Formulation: 50% glycerol
• Gene: HARS2
• Gene Accession No.: NM_012208
• Gene Alias: HARSL/HARSR/HO3
• Gene Symbols: HARS2
• Host Species: Mouse
• Immunogen: HARSL (NP_036340, 2 a.a. ∼ 110 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 23438
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum