Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HEYL, Mouse, Clone: 1C4, Abnova™

Catalog No. 89002618 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-002-618 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-002-618 Supplier Abnova Corporation Supplier No. H00026508M14
Only null left
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant HEYL.

This gene encodes a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. The sequence of the encoded protein contains a conserved bHLH and orange domain, but its YRPW motif has diverged from other HESR family members. It is thought to be an effector of Notch signaling and a regulator of cell fate decisions. Alternatively spliced transcript variants have been found, but their biological validity has not been determined. [provided by RefSeq

Sequence: MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKRRGIIEKRRRDRINSSLSELRRLV

Specifications

Antigen HEYL
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1C4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant HEYL.
Formulation PBS with no preservative; pH 7.4
Gene HEYL
Gene Accession No. NM_014571
Gene Alias HRT3/MGC12623/bHLHb33
Gene Symbols HEYL
Host Species Mouse
Immunogen HEYL (NP_055386, 1 a.a. ∼ 70 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 26508
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.