HLA-DMB, Mouse, Clone: 2D3, Abnova™

Catalog No.	Quantity
89-022-497	100 μg

Catalog No. 89-022-497 Supplier Abnova Corporation Supplier No. H00003109M02

Description

Mouse monoclonal antibody raised against a partial recombinant HLA-DMB.

HLA-DMB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta (DMB) chain, both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP (class II-associated invariant chain peptide) molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. [provided by RefSeq

Sequence: VAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTRE

Specifications

• Antigen: HLA-DMB
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 2D3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant HLA-DMB.
• Formulation: PBS with no preservative; pH 7.4
• Gene: HLA-DMB
• Gene Accession No.: NM_002118
• Gene Alias: D6S221E/RING7
• Gene Symbols: HLA-DMB
• Host Species: Mouse
• Immunogen: HLA-DMB (NP_002109, 22 a.a. ∼ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3109
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ