HMOX1 (A02), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-001	50 μL

Catalog No. 89-003-001 Supplier Abnova Corporation Supplier No. H00003162A02

Description

Mouse polyclonal antibody raised against a partial recombinant HMOX1.

Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. [provided by RefSeq

Sequence: MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPA

Specifications

• Antigen: HMOX1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant HMOX1.
• Formulation: 50% glycerol
• Gene: HMOX1
• Gene Accession No.: NM_002133
• Gene Alias: HO-1/HSP32/bK286B10
• Gene Symbols: HMOX1
• Host Species: Mouse
• Immunogen: HMOX1 (ENSP00000216117, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3162
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid