inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma, Mouse, Clone: 1D4, Abnova™

Catalog No.	Quantity
89-001-084	100 μg

Catalog No. 89-001-084 Supplier Abnova Corporation Supplier No. H00008517M02

Description

Mouse monoclonal antibody raised against a partial recombinant IKBKG.

This gene encodes the regulatory subunit of the inhibitor of kappaB kinase (IKK) complex, which activates NF-kappaB resulting in activation of genes involved in inflammation, immunity, cell survival, and other pathways. Mutations in this gene result in incontinentia pigmenti, hypohidrotic ectodermal dysplasia, and several other types of immunodeficiencies. Multiple transcript variants encoding different isoforms have been found for this gene. A pseudogene highly similar to this locus is located in an adjacent region of the X chromosome. [supplied by RefSeq

Sequence: MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLE

Specifications

• Antigen: inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 1D4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant IKBKG.
• Formulation: PBS with no preservative; pH 7.4
• Gene: IKBKG
• Gene Accession No.: NM_003639
• Gene Alias: AMCBX1/FIP-3/FIP3/Fip3p/IKK-gamma/IP/IP1/IP2/IPD2/NEMO
• Gene Symbols: IKBKG
• Host Species: Mouse
• Immunogen: IKBKG (NP_003630, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Apoptosis
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 8517
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ