interleukin 10, Mouse, Clone: 1C10, Abnova™

Catalog No.	Quantity
89-000-751	50 μg

Catalog No. 89-000-751 Supplier Abnova Corporation Supplier No. H00003586M03

Description

Mouse monoclonal antibody raised against a partial recombinant IL10.

The protein encoded by this gene is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. [provided by RefSeq

Sequence: FKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Specifications

• Antigen: interleukin 10
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1C10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant IL10.
• Formulation: PBS with no preservative; pH 7.4
• Gene: IL10
• Gene Accession No.: NM_000572
• Gene Alias: CSIF/IL-10/IL10A/MGC126450/MGC126451/TGIF
• Gene Symbols: IL10
• Host Species: Mouse
• Immunogen: IL10 (AAI04253.1, 74 a.a. ∼ 178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 50 μg
• Regulatory Status: RUO
• Research Discipline: Apoptosis
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 3586
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG3 κ