Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001409

LAG1 homolog, ceramide synthase 6, Mouse, Clone: 6B8, Abnova™

Catalog No. 89001409 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-409 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-409 Supplier Abnova Corporation Supplier No. H00253782M02
Only null left
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant LASS6.

Sequence: PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTR

Specifications

Antigen LAG1 homolog, ceramide synthase 6
Applications ELISA, Western Blot
Classification Monoclonal
Clone 6B8
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant LASS6.
Formulation PBS with no preservative; pH 7.4
Gene LASS6
Gene Accession No. NM_203463
Gene Alias CerS6/MGC129949/MGC129950
Gene Symbols LASS6
Host Species Mouse
Immunogen LASS6 (NP_982288, 62 a.a. ∼ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 253782
Target Species Human, Rat
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.