lethal giant larvae homolog 1 (Drosophila), Mouse, Clone: 5G2, Abnova™

Catalog No.	Quantity
89-015-833	100 μg

Catalog No. 89-015-833 Supplier Abnova Corporation Supplier No. H00003996M01

Description

Mouse monoclonal antibody raised against a partial recombinant LLGL1.

This gene encodes a protein that is similar to a tumor suppressor in Drosophila. The protein is part of a cytoskeletal network and is associated with nonmuscle myosin II heavy chain and a kinase that specifically phosphorylates this protein at serine residues. The gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq

Sequence: GIASCVFTRHGQGFYLISPSEFERFSLSARNITEPLCSLDINWPRDATQASYRIRESPKLSQANGTPSILLAPQSLDGSPDPAHSMGPDTPEPPEAALSP

Specifications

• Antigen: lethal giant larvae homolog 1 (Drosophila)
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 5G2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant LLGL1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: LLGL1
• Gene Accession No.: NM_004140
• Gene Alias: DLG4/HUGL/HUGL-1/HUGL1/LLGL
• Gene Symbols: LLGL1
• Host Species: Mouse
• Immunogen: LLGL1 (NP_004131, 911 a.a. ∼ 1010 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3996
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ