membrane protein, palmitoylated 4 (MAGUK p55 subfamily member 4), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-699	50 μL

Catalog No. 89-004-699 Supplier Abnova Corporation Supplier No. H00058538A01

Description

Mouse polyclonal antibody raised against a partial recombinant MPP4.

This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) protein family, with an N-terminal PDZ domain, a central src homology 3 region (SH3), and a C-terminal guanylate kinase-like (GUK) domain. The protein is localized to the outer limiting membrane in the retina, and is thought to function in photoreceptor polarity and the organization of specialized intercellular junctions. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq

Sequence: MIQSDKGADPPDKKDMKLSTATNPQNGLSQILRLVLQELSLFYSRDVNGVCLLYDLLHSPWLQALLKIYDCLQEFKEKKLVPATPHAQVLSYEVVELLRETPTSPEIQE

Specifications

• Antigen: membrane protein, palmitoylated 4 (MAGUK p55 subfamily member 4)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant MPP4.
• Formulation: 50% glycerol
• Gene: MPP4
• Gene Accession No.: NM_033066
• Gene Alias: ALS2CR5/DLG6
• Gene Symbols: MPP4
• Host Species: Mouse
• Immunogen: MPP4 (NP_149055, 1 a.a. ∼ 109 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 58538
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum