Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

membrane protein, palmitoylated 4 (MAGUK p55 subfamily member 4), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant MPP4.

Manufacturer:  Abnova Corporation H00058538A01

Catalog No. 89-004-699


Add to cart

Description

Description

This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) protein family, with an N-terminal PDZ domain, a central src homology 3 region (SH3), and a C-terminal guanylate kinase-like (GUK) domain. The protein is localized to the outer limiting membrane in the retina, and is thought to function in photoreceptor polarity and the organization of specialized intercellular junctions. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq

Sequence: MIQSDKGADPPDKKDMKLSTATNPQNGLSQILRLVLQELSLFYSRDVNGVCLLYDLLHSPWLQALLKIYDCLQEFKEKKLVPATPHAQVLSYEVVELLRETPTSPEIQE
Specifications

Specifications

membrane protein, palmitoylated 4 (MAGUK p55 subfamily member 4)
Unconjugated
50% glycerol
NM_033066
ALS2CR5|DLG6
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
58538
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant MPP4.
MPP4
Serum
MPP4
MPP4 (NP_149055, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit