microseminoprotein, beta-, Mouse, Clone: 3B11, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant MSMB.

Supplier:  Abnova Corporation H00004477M08

Catalog No. 89-000-814

Description

The protein encoded by this gene is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in uterine, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer. Two alternatively spliced transcript variants encoding different isoforms are described for this gene. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq

Sequence: MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII

Specifications

• Antigen: microseminoprotein, beta-
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC005257
• Gene Symbols: MSMB
• Immunogen: MSMB (AAH05257.1, 1 a.a. ∼ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 4477
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ

• Applications: ELISA, Western Blot
• Clone: 3B11
• Description: Mouse monoclonal antibody raised against a full length recombinant MSMB.
• Gene: MSMB
• Gene Alias: HPC13/IGBF/MSP/MSPB/PN44/PRPS/PSP/PSP-94/PSP57/PSP94
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody