microseminoprotein, beta-, Mouse, Clone: 3B11, Abnova™

Catalog No.	Quantity
89-000-814	100 μg

Catalog No. 89-000-814 Supplier Abnova Corporation Supplier No. H00004477M08

Description

Mouse monoclonal antibody raised against a full-length recombinant MSMB.

The protein encoded by this gene is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in uterine, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer. Two alternatively spliced transcript variants encoding different isoforms are described for this gene. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq

Sequence: MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII

Specifications

• Antigen: microseminoprotein, beta-
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3B11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant MSMB.
• Formulation: PBS with no preservative; pH 7.4
• Gene: MSMB
• Gene Accession No.: BC005257
• Gene Alias: HPC13/IGBF/MSP/MSPB/PN44/PRPS/PSP/PSP-94/PSP57/PSP94
• Gene Symbols: MSMB
• Host Species: Mouse
• Immunogen: MSMB (AAH05257.1, 1 a.a. ∼ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 4477
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ