MSX1, Rabbit, MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-002-899	100 μL

Catalog No. 89-002-899 Supplier Abnova Corporation Supplier No. H00004487D01

Description

Rabbit polyclonal antibody raised against a full-length human MSX1 protein.

This gene encodes a member of the muscle segment homeobox gene family. The encoded protein functions as a transcriptional repressor during embryogenesis through interactions with components of the core transcription complex and other homeoproteins. It may also have roles in limb-pattern formation, craniofacial development, particularly odontogenesis, and tumor growth inhibition. Mutations in this gene, which was once known as homeobox 7, have been associated with nonsyndromic cleft lip with or without cleft palate 5, Witkop syndrome, Wolf-Hirschom syndrome, and autosomoal dominant hypodontia. [provided by RefSeq

Sequence: MTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSPSLLPFSVEALMADHRKPGAKESALAPSEGVQAAGGSAQPLGVPPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT

Specifications

• Antigen: MSX1
• Applications: Immunoprecipitation, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against a full-length human MSX1 protein.
• Formulation: No additive
• Gene: MSX1
• Gene Accession No.: NM_002448.2
• Gene Alias: HOX7/HYD1
• Gene Symbols: MSX1
• Host Species: Rabbit
• Immunogen: MSX1 (AAH67353.1, 1 a.a. ∼ 297 a.a) full-length human protein.
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4487
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid